DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hspb9

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_083583.2 Gene:Hspb9 / 75482 MGIID:1922732 Length:168 Species:Mus musculus


Alignment Length:121 Identity:27/121 - (22%)
Similarity:52/121 - (42%) Gaps:22/121 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEG--NHEEREDDHG--FITRHFVRRYALPPGYEADKVAS 131
            ||:.:|...|.|.:|||::...::.|.|  .||..:...|  .:.:...|:..|||..:...:..
Mouse    57 FQIKVDAQGFAPEDLVVRIDGQNLTVTGQRQHESNDPSRGRYRMEQSVHRQMQLPPTLDPAAMTC 121

  Fly   132 TLSSDGVLTIK-----VPKPPAIEDKGNERIVQIQQVGPAHLNVKENPKEAVEQDN 182
            :|:..|.|.::     :|.|.|             |.|.:....:..||.:::.::
Mouse   122 SLTPSGHLWLRGQNKCLPPPEA-------------QTGQSQKPRRGGPKSSLQNES 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 20/82 (24%)
IbpA <69..161 CDD:223149 23/98 (23%)
Hspb9NP_083583.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
ACD_HspB9_like 50..135 CDD:107236 20/77 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..104 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..168 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.