DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hspb9

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_083583.2 Gene:Hspb9 / 75482 MGIID:1922732 Length:168 Species:Mus musculus


Alignment Length:121 Identity:27/121 - (22%)
Similarity:52/121 - (42%) Gaps:22/121 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEG--NHEEREDDHG--FITRHFVRRYALPPGYEADKVAS 131
            ||:.:|...|.|.:|||::...::.|.|  .||..:...|  .:.:...|:..|||..:...:..
Mouse    57 FQIKVDAQGFAPEDLVVRIDGQNLTVTGQRQHESNDPSRGRYRMEQSVHRQMQLPPTLDPAAMTC 121

  Fly   132 TLSSDGVLTIK-----VPKPPAIEDKGNERIVQIQQVGPAHLNVKENPKEAVEQDN 182
            :|:..|.|.::     :|.|.|             |.|.:....:..||.:::.::
Mouse   122 SLTPSGHLWLRGQNKCLPPPEA-------------QTGQSQKPRRGGPKSSLQNES 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 20/82 (24%)
Hspb9NP_083583.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
ACD_HspB9_like 50..135 CDD:107236 20/77 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..104 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..168 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.