DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hspb3

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001092922.1 Gene:hspb3 / 568180 ZFINID:ZDB-GENE-070705-338 Length:150 Species:Danio rerio


Alignment Length:90 Identity:30/90 - (33%)
Similarity:51/90 - (56%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRY 118
            ||.:.|....|  |:..||:.:||:.|||.:::::|.:..:|:.|.|..|..:||.::|.|.|.|
Zfish    53 GAQADSEDEDS--GEPMFQILLDVTQFKPEDILIQVFEGWLLIRGRHGVRMGEHGLVSRSFTRHY 115

  Fly   119 ALPP-GYEADKVASTLSSDGVLTIK 142
            .||. ...|..:.:.|..||:|.::
Zfish   116 QLPDCQLHAGDLKAMLCHDGMLVVE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 26/77 (34%)
IbpA <69..161 CDD:223149 25/75 (33%)
hspb3NP_001092922.1 ACD_HspB3_Like 60..143 CDD:107232 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.