DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hspb2

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001017744.1 Gene:hspb2 / 550439 ZFINID:ZDB-GENE-050417-260 Length:169 Species:Danio rerio


Alignment Length:158 Identity:48/158 - (30%)
Similarity:71/158 - (44%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVV 87
            |..||.:.:.|..|      |:...|:|.:               .|.::|.:||..|.|.|:.|
Zfish    44 YHGYYIRPRINKQL------ERGFSQVESE---------------DDWYRVLLDVCQFTPDEISV 87

  Fly    88 KVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIEDK 152
            :..||.:.|...|.:|.|.|||::|.|.|.|.||.|.:...|..:||.||:|.|:.|:      |
Zfish    88 RTVDNLLEVSARHAQRMDQHGFVSREFTRTYILPMGVDPLLVQVSLSHDGILCIQAPR------K 146

  Fly   153 GNERIVQIQQVGPAHLNVKENPKEAVEQ 180
            ..:...||.|     |.:|...||:..:
Zfish   147 TEDLEPQINQ-----LKIKVEKKESTSK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 31/77 (40%)
IbpA <69..161 CDD:223149 34/91 (37%)
hspb2NP_001017744.1 ACD_HspB2_like 63..145 CDD:107231 33/96 (34%)
IbpA <64..162 CDD:223149 39/123 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.