DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and cryabb

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021331756.1 Gene:cryabb / 436943 ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio


Alignment Length:147 Identity:51/147 - (34%)
Similarity:78/147 - (53%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RMSMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVS--KIGKDGFQVCMDVS 78
            |..:.|.:.|   :||...::.....:.....|....:.:.|.....||  |:.||.|.:.:||.
Zfish    10 RRILFPIFFP---RRQFGEHITEADVISSLYSQRSSFLRSPSWMESGVSEVKMEKDQFSLSLDVK 71

  Fly    79 HFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKV 143
            ||.|.||.||:..:.:.:...||:|:|.|||::|.|:|:|.:|.|.:...:.|:||||||||  |
Zfish    72 HFAPEELSVKIIGDFIEIHAKHEDRQDGHGFVSREFLRKYRVPVGVDPASITSSLSSDGVLT--V 134

  Fly   144 PKPPAIEDKGNERIVQI 160
            ..|..:.| |.||.:.|
Zfish   135 TGPLKLSD-GPERTIAI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 35/77 (45%)
IbpA <69..161 CDD:223149 40/92 (43%)
cryabbXP_021331756.1 Crystallin 1..48 CDD:306911 6/40 (15%)
ACD_HspB4-5-6 56..137 CDD:107233 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.