DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hsp26

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster


Alignment Length:201 Identity:100/201 - (49%)
Similarity:127/201 - (63%) Gaps:21/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NIPLLLSLADDLGRMSMVPFYE-------------PYYCQRQRN----PYLALV---GPMEQQLR 47
            ::..||||.|:| :....|.||             |...|::|:    |..:.:   .|..|.|.
  Fly     2 SLSTLLSLVDEL-QEPRSPIYELGLGLHPHSRYVLPLGTQQRRSINGCPCASPICPSSPAGQVLA 65

  Fly    48 QLEKQVGASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITR 112
            ...:....:.....|.:.:|||||||||||:.||||||.|||.|:|:||||.||||:||||.|.|
  Fly    66 LRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMR 130

  Fly   113 HFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQQVGPAHLNVKENPKEA 177
            ||||||.:|.||:|::|.|.||||||||:.:|||.|:|||..|||:|||||||||||||.|..|.
  Fly   131 HFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEV 195

  Fly   178 VEQDNG 183
            ..::||
  Fly   196 KGKENG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 56/77 (73%)
IbpA <69..161 CDD:223149 65/91 (71%)
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 56/77 (73%)
IbpA <87..179 CDD:223149 65/91 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469593
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5925
109.900

Return to query results.
Submit another query.