DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hspb1

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001008615.2 Gene:hspb1 / 368243 ZFINID:ZDB-GENE-030326-4 Length:199 Species:Danio rerio


Alignment Length:135 Identity:58/135 - (42%)
Similarity:86/135 - (63%) Gaps:9/135 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MVPFYEPYYCQRQRNPYLALVGPM--EQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCMDVSHFK 81
            |.||..|.:....:.|  .::.||  ....|.|.:|:  |||.| .|.:.| |.:::.:||:||.
Zfish    54 MRPFGHPEFASLMQGP--PVMPPMMTPSYGRALSRQL--SSGMS-EVKQTG-DSWKISLDVNHFS 112

  Fly    82 PSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKP 146
            |.||.||.:|..:.:.|.||||:|:||||:|.|.|:|.||||.:::|::|.||.:||||::.|.|
Zfish   113 PEELNVKTKDGVLEITGKHEERKDEHGFISRCFTRKYTLPPGVDSEKISSCLSPEGVLTVEAPLP 177

  Fly   147 -PAIE 150
             |||:
Zfish   178 KPAIQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 38/77 (49%)
IbpA <69..161 CDD:223149 42/83 (51%)
hspb1NP_001008615.2 ACD_HspB1_like 91..176 CDD:107230 41/86 (48%)
IbpA <94..191 CDD:223149 44/90 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7249
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4974
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25916
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.