DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and CG13133

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster


Alignment Length:169 Identity:56/169 - (33%)
Similarity:88/169 - (52%) Gaps:23/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAV-------------SKIGKDGFQVCMDVSHFK 81
            |||:.||:  ..::...|....::..|:...|:.             ..:|:..|:|.:||.||:
  Fly    35 RQRHYYLS--HDLDVCARDFHLRMDDSAWCHGSCLVGRVVIETGTEPDSLGRGTFKVVLDVHHFQ 97

  Fly    82 PSELVVKVQD-NSVLVEGNHEEREDDHG--FITRHFVRRYALPPGYEADKVASTLSSDGVLTIKV 143
            .|||.||.:: ::|.|||...:...:.|  .|||.|.|.|.||..|:|.:..:|.|:||:|.|.|
  Fly    98 ISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARATFSADGILMITV 162

  Fly   144 PKPPAIEDKGNERIVQIQQVGPAHLNVKE--NPKEAVEQ 180
            |.||.::|.  ||.::|:..|....:|.:  .|| |:||
  Fly   163 PAPPKLDDV--EREIEIEPTGNYFGSVSDPTAPK-AIEQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 34/80 (43%)
IbpA <69..161 CDD:223149 39/94 (41%)
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 32/75 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.