DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and HSPB2

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001532.1 Gene:HSPB2 / 3316 HGNCID:5247 Length:182 Species:Homo sapiens


Alignment Length:161 Identity:48/161 - (29%)
Similarity:72/161 - (44%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKI----GKDGFQVCMDVSHFKPS 83
            |..||.:.:..|                    |..||....|::    ||  ||..:|||||.|.
Human    44 YHGYYVRPRAAP--------------------AGEGSRAGASELRLSEGK--FQAFLDVSHFTPD 86

  Fly    84 ELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPA 148
            |:.|:..||.:.|...|.:|.|.|||::|.|.|.|.||...:..:|.:.||.||:|.::.|:   
Human    87 EVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPR--- 148

  Fly   149 IEDKGNERIVQIQQVGPAHLNVKENPKEAVE 179
               .|.....::.:|..:.|....:|:|..|
Human   149 ---GGRHLDTEVNEVYISLLPAPPDPEEEEE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 33/77 (43%)
HSPB2NP_001532.1 Crystallin <21..51 CDD:425732 3/6 (50%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 67..148 CDD:469641 33/82 (40%)

Return to query results.
Submit another query.