DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and cryaba

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_571232.1 Gene:cryaba / 30393 ZFINID:ZDB-GENE-991119-2 Length:168 Species:Danio rerio


Alignment Length:153 Identity:50/153 - (32%)
Similarity:70/153 - (45%) Gaps:51/153 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PFYEPYYCQRQRNPYL--------ALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCMDV 77
            |||..:|.:    |||        :.:..|.|.                      :|.|.:.:||
Zfish    40 PFYTMFYYR----PYLWRFPSWWDSGMSEMRQD----------------------RDRFVINLDV 78

  Fly    78 SHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTI- 141
            .||.|.||.|||.::.:.:.|.|:||:||||.:.|.|.|:|.:|.|.:...:.|:||||||||| 
Zfish    79 KHFSPDELTVKVNEDFIEIHGKHDERQDDHGIVAREFFRKYKIPAGVDPGAITSSLSSDGVLTIN 143

  Fly   142 -----------KVP-----KPPA 148
                       .:|     ||||
Zfish   144 TLRHQLDILERSIPIICGEKPPA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 37/94 (39%)
IbpA <69..161 CDD:223149 41/97 (42%)
cryabaNP_571232.1 Crystallin 1..49 CDD:278926 4/12 (33%)
IbpA 11..142 CDD:223149 43/127 (34%)
alpha-crystallin-Hsps_p23-like 64..143 CDD:294116 37/100 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582872
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.