DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hspb7

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_038896.2 Gene:Hspb7 / 29818 MGIID:1352494 Length:169 Species:Mus musculus


Alignment Length:123 Identity:31/123 - (25%)
Similarity:49/123 - (39%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PMEQQLRQLEKQVG-------------ASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVVKVQDN 92
            |||:.|.......|             |..|..|.:..:| |.::..:|:..|.|.:::|...:|
Mouse    39 PMEKALSMFSDDFGSFMLPHSEPLAFPARPGGQGNIKTLG-DAYEFTVDMRDFSPEDIIVTTFNN 102

  Fly    93 SVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIE 150
            .:.|..   |:....|.:...|..:..||...:...|.|.|..||.|||:..:.|..|
Mouse   103 HIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 21/77 (27%)
IbpA <69..161 CDD:223149 22/82 (27%)
Hspb7NP_038896.2 Required for localization to SC35 splicing speckles. /evidence=ECO:0000250 1..70 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
ACD_HspB7_like 72..152 CDD:107234 22/83 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.