DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hsp16

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_596091.1 Gene:hsp16 / 2540977 PomBaseID:SPBC3E7.02c Length:143 Species:Schizosaccharomyces pombe


Alignment Length:104 Identity:23/104 - (22%)
Similarity:47/104 - (45%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GKDGFQVCMDVSHFKPSELVVKVQDNSVLVEG------NHEEREDDHGFITRH---FVRRYALPP 122
            |||...|.:::...|..::.|......:.:.|      .:|..|.:..:..|.   |.|...:|.
pombe    44 GKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPA 108

  Fly   123 GYEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQ 161
            ..:||::.:.. |:|:||:.:||   :|....::.:.|:
pombe   109 KIDADRIEANF-SNGLLTVTLPK---VEKSQTKKQIAIK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 19/86 (22%)
IbpA <69..161 CDD:223149 20/100 (20%)
hsp16NP_596091.1 IbpA 1..143 CDD:223149 22/102 (22%)
ACD_sHsps-like 40..130 CDD:107221 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.