DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hspb1

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_114176.4 Gene:Hspb1 / 24471 RGDID:61306 Length:206 Species:Rattus norvegicus


Alignment Length:124 Identity:52/124 - (41%)
Similarity:75/124 - (60%) Gaps:14/124 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PYLALVGPMEQQL------RQLEKQVGASSGSSGAVSKIGK--DGFQVCMDVSHFKPSELVVKVQ 90
            |.....||....|      |.|.:|:     ||| ||:|.:  |.::|.:||:||.|.||.||.:
  Rat    60 PAATAEGPAAVTLAAPAFSRALNRQL-----SSG-VSEIRQTADRWRVSLDVNHFAPEELTVKTK 118

  Fly    91 DNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAI 149
            :..|.:.|.||||:|:||:|:|.|.|:|.||||.:...|:|:||.:|.||::.|.|.|:
  Rat   119 EGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 36/79 (46%)
IbpA <69..161 CDD:223149 39/81 (48%)
Hspb1NP_114176.4 Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:11546764 74..206 48/110 (44%)
ACD_HspB1_like 88..173 CDD:107230 40/85 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.