DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hspb6

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_620242.1 Gene:Hspb6 / 192245 RGDID:621554 Length:162 Species:Rattus norvegicus


Alignment Length:133 Identity:53/133 - (39%)
Similarity:63/133 - (47%) Gaps:33/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVVKV 89
            |||.   |.|.:||.          ..||....|.           |.|.:||.||.|.|:.|||
  Rat    52 PYYL---RAPSVALP----------TAQVPTDPGY-----------FSVLLDVKHFSPEEISVKV 92

  Fly    90 QDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIK---------VPK 145
            ..:.|.|...||||.|:||||.|.|.|||.||||.:...|.|.||.:|||:|:         :|.
  Rat    93 VGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQASLPS 157

  Fly   146 PPA 148
            |||
  Rat   158 PPA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 39/86 (45%)
IbpA <69..161 CDD:223149 43/89 (48%)
Hspb6NP_620242.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 9/32 (28%)
Crystallin 3..58 CDD:395419 4/8 (50%)
ACD_HspB4-5-6 66..148 CDD:107233 42/92 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.