DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and ZK1128.7

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_499252.2 Gene:ZK1128.7 / 191528 WormBaseID:WBGene00014233 Length:205 Species:Caenorhabditis elegans


Alignment Length:123 Identity:34/123 - (27%)
Similarity:56/123 - (45%) Gaps:25/123 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEPYYCQ----RQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCMDVSHFKPS 83
            |:.||.:    |.|:|     ||:               ..:|.::.. ..||.:.:||.||.|.
 Worm    73 YDSYYTKITESRPRSP-----GPV---------------AGAGEITNT-SHGFTIEIDVFHFMPE 116

  Fly    84 ELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTI 141
            |:.|.:.|:::.:.|...|...|...:.|.|.|:|::|.....|.:.|.|::.|||.|
 Worm   117 EIKVVLTDDTLSISGERFESTGDGHTLRRSFSRKYSIPDDVHLDTIRSHLTNSGVLII 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 25/75 (33%)
IbpA <69..161 CDD:223149 25/73 (34%)
ZK1128.7NP_499252.2 metazoan_ACD 96..178 CDD:107247 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.