DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Y55F3BR.6

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001368623.1 Gene:Y55F3BR.6 / 190317 WormBaseID:WBGene00021943 Length:253 Species:Caenorhabditis elegans


Alignment Length:155 Identity:50/155 - (32%)
Similarity:79/155 - (50%) Gaps:28/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DLGRM--SMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCM 75
            |||.:  ||:..:          |.||:..|         ..||:.:|:..:: ::....|...:
 Worm   114 DLGNIHSSMLSNF----------PNLAISSP---------SVVGSQNGNLTSI-RVTNTSFHAIL 158

  Fly    76 DVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLT 140
            |||.:....|.|.|.||:::|||:|.|:||.:|.|...|.||:.||.....:.|.|.|::||.||
 Worm   159 DVSKYDADSLKVTVVDNNIIVEGSHGEKEDTYGTIESTFKRRFPLPKAVAPESVQSQLTADGHLT 223

  Fly   141 I--KVPKPPAIEDKGNERIVQIQQV 163
            |  |.|:|   :.:| .|.:||:.:
 Worm   224 IDAKAPEP---KQEG-ARPIQIKVI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 32/79 (41%)
IbpA <69..161 CDD:223149 37/93 (40%)
Y55F3BR.6NP_001368623.1 metazoan_ACD 150..227 CDD:107247 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.