DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hsp-12.1

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001076614.1 Gene:hsp-12.1 / 188710 WormBaseID:WBGene00011906 Length:112 Species:Caenorhabditis elegans


Alignment Length:78 Identity:26/78 - (33%)
Similarity:40/78 - (51%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEGNH---EEREDDHGFITRHFVRRYALPPGYEADKVAST 132
            |:|.:|...|.|:::.|||....:::...|   :.|..::|.:.|...|.|.||...:...|.|.
 Worm    34 FEVGLDAGFFGPNDIDVKVNGIEIIIHLRHDLLQNRPTEYGIVNREVHRTYKLPEDVDPSTVRSH 98

  Fly   133 LSSDGVLTIKVPK 145
            |:|.|||||...|
 Worm    99 LNSSGVLTITANK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 25/76 (33%)
IbpA <69..161 CDD:223149 26/78 (33%)
hsp-12.1NP_001076614.1 metazoan_ACD 26..111 CDD:107247 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14686
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.