DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hsp-17

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001023957.1 Gene:hsp-17 / 186113 WormBaseID:WBGene00002021 Length:149 Species:Caenorhabditis elegans


Alignment Length:138 Identity:46/138 - (33%)
Similarity:70/138 - (50%) Gaps:25/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PFYEPYYCQRQR------------NPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKD-GFQ 72
            |.:.|::...:|            .||.|      .|......:||      .|:..:..| .:.
 Worm     6 PPFSPFFNHGRRFFDDVDFDRHMIRPYWA------DQTMLTGHRVG------DAIDVVNNDQEYN 58

  Fly    73 VCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDG 137
            |.:|||.|:|.||.|.:.||.:::||.|.|:.|.:|.:.|||||:|.||.|...:::.|.||::|
 Worm    59 VSVDVSQFEPEELKVNIVDNQLIIEGKHNEKTDKYGQVERHFVRKYNLPTGVRPEQIKSELSNNG 123

  Fly   138 VLTIKVPK 145
            |||:|..|
 Worm   124 VLTVKYEK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 35/78 (45%)
IbpA <69..161 CDD:223149 36/78 (46%)
hsp-17NP_001023957.1 metazoan_ACD 49..128 CDD:107247 34/78 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I4799
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.