DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and F08H9.3

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_506585.1 Gene:F08H9.3 / 184214 WormBaseID:WBGene00008591 Length:147 Species:Caenorhabditis elegans


Alignment Length:149 Identity:36/149 - (24%)
Similarity:61/149 - (40%) Gaps:38/149 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSG----AVSKIGKD-------- 69
            ||:.||::|                     |.|.:.|...:|...    .:|:...|        
 Worm     1 MSVNPFFDP---------------------RTLGEMVFGDNGRLDREYVPISENNDDLSDCRNEI 44

  Fly    70 -----GFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKV 129
                 .|.|.::|...||.||.:.::...:.::..|:|.|:|:...|:.:.:...||...:...:
 Worm    45 VDTHEKFSVNLNVPDVKPEELKINLEGRKLSIKAEHQEIENDNISTTQTYSKSIVLPEDVDVTHL 109

  Fly   130 ASTLSSDGVLTIKVPKPPA 148
            :|.||.||.|.|:|||..|
 Worm   110 SSNLSEDGKLLIEVPKVEA 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 23/90 (26%)
IbpA <69..161 CDD:223149 26/93 (28%)
F08H9.3NP_506585.1 metazoan_ACD 43..125 CDD:107247 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160444
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.