DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hsp-25

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 / 180872 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans


Alignment Length:132 Identity:38/132 - (28%)
Similarity:62/132 - (46%) Gaps:32/132 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDG--FQVCMDVSH 79
            |:..|.|:| |....::|.:                            |...||  .::..||::
 Worm   112 MAHRPTYDP-YLDNLKSPLI----------------------------KDESDGKTLRLRFDVAN 147

  Fly    80 FKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVP 144
            :||.|:.||..||.:||...|||:.... .:.|.:.:.:.||.|...::::||||:|||||::.|
 Worm   148 YKPEEVTVKTIDNRLLVHAKHEEKTPQR-TVFREYNQEFLLPRGTNPEQISSTLSTDGVLTVEAP 211

  Fly   145 KP 146
            .|
 Worm   212 LP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 29/79 (37%)
IbpA <69..161 CDD:223149 31/80 (39%)
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 30/81 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.