DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hsp-16.48

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_505355.1 Gene:hsp-16.48 / 179287 WormBaseID:WBGene00002019 Length:143 Species:Caenorhabditis elegans


Alignment Length:75 Identity:27/75 - (36%)
Similarity:45/75 - (60%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSS 135
            |.|.:|||||||.:|.:::....:.:|| .:|::.:||:..|.|.:...||...:...|.|.:|:
 Worm    54 FSVQLDVSHFKPEDLKIELDGRELKIEG-IQEKKSEHGYSKRSFSKMILLPEDVDLTSVKSAISN 117

  Fly   136 DGVLTIKVPK 145
            :|.|.|:.||
 Worm   118 EGKLQIEAPK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 25/73 (34%)
IbpA <69..161 CDD:223149 27/75 (36%)
hsp-16.48NP_505355.1 IbpA <46..138 CDD:223149 27/75 (36%)
metazoan_ACD 46..127 CDD:107247 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160413
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.