DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hsp-16.1

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_505354.1 Gene:hsp-16.1 / 179286 WormBaseID:WBGene00002015 Length:145 Species:Caenorhabditis elegans


Alignment Length:151 Identity:47/151 - (31%)
Similarity:80/151 - (52%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQV-----GASSGSSGAVSKIGKDGFQVCMD 76
            ||:..::.|  .||      ::.|.:.:.:.|:|:|.     |:.|.||..|:...|  |.:.::
 Worm     1 MSLYHYFRP--AQR------SVFGDLMRDMAQMERQFTPVCRGSPSESSEIVNNDQK--FAINLN 55

  Fly    77 VSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTI 141
            ||.|||.:|.:.:..:::.::| .:|.:.:||:..:.|.|...||...:...|||.||.||.|:|
 Worm    56 VSQFKPEDLKINLDGHTLSIQG-EQELKTEHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSI 119

  Fly   142 KVPKPPAIEDKGNERIVQIQQ 162
            :.||..||:.    |.:.|||
 Worm   120 EAPKKEAIQG----RSIPIQQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 25/77 (32%)
IbpA <69..161 CDD:223149 29/91 (32%)
hsp-16.1NP_505354.1 IbpA 17..134 CDD:223149 38/123 (31%)
metazoan_ACD 42..123 CDD:107247 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160456
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.