DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hspb1

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_038588.2 Gene:Hspb1 / 15507 MGIID:96240 Length:209 Species:Mus musculus


Alignment Length:124 Identity:52/124 - (41%)
Similarity:75/124 - (60%) Gaps:14/124 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PYLALVGPMEQQL------RQLEKQVGASSGSSGAVSKIGK--DGFQVCMDVSHFKPSELVVKVQ 90
            |.....||....|      |.|.:|:     ||| ||:|.:  |.::|.:||:||.|.||.||.:
Mouse    60 PAATAEGPAAVTLAAPAFSRALNRQL-----SSG-VSEIRQTADRWRVSLDVNHFAPEELTVKTK 118

  Fly    91 DNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAI 149
            :..|.:.|.||||:|:||:|:|.|.|:|.||||.:...|:|:||.:|.||::.|.|.|:
Mouse   119 EGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 36/79 (46%)
IbpA <69..161 CDD:223149 39/81 (48%)
Hspb1NP_038588.2 Interaction with TGFB1I1. /evidence=ECO:0000250 74..209 48/110 (44%)
ACD_HspB1_like 88..173 CDD:107230 40/85 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.