DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and CRYAA

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_000385.1 Gene:CRYAA / 1409 HGNCID:2388 Length:173 Species:Homo sapiens


Alignment Length:171 Identity:55/171 - (32%)
Similarity:80/171 - (46%) Gaps:34/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDLGRMSMVPF----YEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQ 72
            :.|....::||    ..|||                   ||...:....||.|...|  .:|.|.
Human    29 EGLFEYDLLPFLSSTISPYY-------------------RQSLFRTVLDSGISEVRS--DRDKFV 72

  Fly    73 VCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDG 137
            :.:||.||.|.:|.|||||:.|.:.|.|.||:||||:|:|.|.|||.||...:...::.:||:||
Human    73 IFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADG 137

  Fly   138 VLTIKVPK-PPAIEDKGNERIVQIQQVGPAHLNVKENPKEA 177
            :||...|| ...::....||.:.:.:        :|.|..|
Human   138 MLTFCGPKIQTGLDATHAERAIPVSR--------EEKPTSA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 36/77 (47%)
IbpA <69..161 CDD:223149 40/92 (43%)
CRYAANP_000385.1 Crystallin 1..51 CDD:395419 7/40 (18%)
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 39/86 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.