DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Cryab

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001276711.1 Gene:Cryab / 12955 MGIID:88516 Length:175 Species:Mus musculus


Alignment Length:113 Identity:49/113 - (43%)
Similarity:69/113 - (61%) Gaps:7/113 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KIGKDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKV 129
            ::.||.|.|.:||.||.|.||.|||..:.:.|.|.||||:|:||||:|.|.|:|.:|...:...:
Mouse    69 RLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTI 133

  Fly   130 ASTLSSDGVLTIKVPKPPAIEDKGNERIVQI-QQVGPAHLNVKENPKE 176
            .|:||||||||:..|:.   :..|.||.:.| ::..||   |...||:
Mouse   134 TSSLSSDGVLTVNGPRK---QVSGPERTIPITREEKPA---VAAAPKK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 39/77 (51%)
IbpA <69..161 CDD:223149 43/92 (47%)
CryabNP_001276711.1 Crystallin 1..52 CDD:395419
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 40/80 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..175 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.