DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hspb6

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 / 100494296 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis


Alignment Length:144 Identity:54/144 - (37%)
Similarity:73/144 - (50%) Gaps:22/144 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCMDVSHFK 81
            |.|.....|||   .|:|  ::..|.|..|.::               |:.||.|.|.:||.||.
 Frog    42 MPMPMALSPYY---YRSP--SIPQPSEAGLSEV---------------KLDKDQFSVLLDVKHFS 86

  Fly    82 PSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKP 146
            |.||.|||..:.|.|...||||.|:||||:|.|.|||.:||......::|.||::|:|:|:.|..
 Frog    87 PEELTVKVVGDYVEVHAKHEERPDEHGFISREFHRRYKIPPTVSPAAISSALSAEGLLSIQAPVT 151

  Fly   147 PAIEDKGNERIVQI 160
            ..  .|..||.:.|
 Frog   152 AG--GKQEERSIPI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 38/77 (49%)
IbpA <69..161 CDD:223149 42/92 (46%)
hspb6XP_002940672.2 Crystallin 1..56 CDD:366148 6/16 (38%)
ACD_HspB4-5-6 68..149 CDD:107233 39/95 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.