DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and LOC100489058

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017950961.1 Gene:LOC100489058 / 100489058 -ID:- Length:215 Species:Xenopus tropicalis


Alignment Length:192 Identity:55/192 - (28%)
Similarity:86/192 - (44%) Gaps:37/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSLADDLGRMSMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQ-----VGASSGSSGAVSKI 66
            :||:.:|:.|...        |..:....|:    .:..:|::..|     ...:.|:|.:..|.
 Frog    39 ILSMRNDMERRMQ--------CVNEAYRLLS----QDMDMRRITDQSRQPRATETEGTSPSSGKD 91

  Fly    67 GKDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDD------HGFITRHFVRRYALPPGYE 125
            |||.|::.:||..|.|.||.||:|...|:|.|..|.:.|.      |.:  |.:.|...||.|..
 Frog    92 GKDHFELTLDVRDFSPHELTVKMQGRRVIVIGKQERKSDSENGSYVHEY--REWKREAELPEGVN 154

  Fly   126 ADKVASTLSSDGVLTIKVPK---PPAIEDKGNERIVQIQQVGPAHLNVKENPKEAVEQDNGN 184
            .::|..:.|.||.|.|:.|:   |||     .||.:.| .:.||..:.:|.|.:|   .|.|
 Frog   155 PEQVVCSFSKDGHLHIQAPRLALPPA-----PERPIPI-SMDPAPRDAQEIPPDA---QNSN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 30/83 (36%)
IbpA <69..161 CDD:223149 34/100 (34%)
LOC100489058XP_017950961.1 ACD_HspB9_like 88..174 CDD:107236 31/87 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.