DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and cryaa

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_031752202.1 Gene:cryaa / 100488185 XenbaseID:XB-GENE-5940571 Length:115 Species:Xenopus tropicalis


Alignment Length:96 Identity:39/96 - (40%)
Similarity:62/96 - (64%) Gaps:1/96 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVAST 132
            :|.|.:.:||.||.|.:|.||:.|:.|.:.|.|.||:||||:|:|.|.|||.||...:.:.|:.|
 Frog    12 RDRFFINLDVKHFSPEDLSVKLHDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQNSVSCT 76

  Fly   133 LSSDGVLTIKVPK-PPAIEDKGNERIVQIQQ 162
            ||:||:|:...|| .|.::...::|.:.:.:
 Frog    77 LSADGILSFSGPKLQPNVDSSHSDRTIPVSR 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 35/76 (46%)
IbpA <69..161 CDD:223149 39/92 (42%)
cryaaXP_031752202.1 alpha-crystallin-Hsps_p23-like 5..89 CDD:412199 35/76 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I4986
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.