DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hspb3

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002941074.1 Gene:hspb3 / 100135387 XenbaseID:XB-GENE-969539 Length:145 Species:Xenopus tropicalis


Alignment Length:85 Identity:28/85 - (32%)
Similarity:51/85 - (60%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTL 133
            |.|:|.:||..|:|.:::::|.:..::::|.|..|.|:||||:|.|.|.|.||.|.....:::..
 Frog    61 DKFKVLLDVVQFRPEDIIIQVFEGWLIIKGEHGCRMDEHGFISRSFTRTYQLPNGIGLTDLSAFF 125

  Fly   134 SSDGVLTIKVPKPPAIEDKG 153
            ..||:|.::..:...:..||
 Frog   126 CHDGILAVEGKQKQGLALKG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 26/75 (35%)
IbpA <69..161 CDD:223149 28/85 (33%)
hspb3XP_002941074.1 alpha-crystallin-Hsps_p23-like 55..137 CDD:381838 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.