DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and cryaa

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_694482.1 Gene:cryaa / 100000769 ZFINID:ZDB-GENE-020508-1 Length:173 Species:Danio rerio


Alignment Length:146 Identity:50/146 - (34%)
Similarity:73/146 - (50%) Gaps:22/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MVPF----YEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCMDVSH 79
            :.||    ..|||                  ...|.:.:..||.|..:..:..::.|.|.:||.|
Zfish    34 LFPFTTSTVSPYY------------------RHSLFRNILDSSNSGVSEVRSDREKFTVYLDVKH 80

  Fly    80 FKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVP 144
            |.|.||.|||.|:.|.::|.|.||:||||:|:|.|.|||.||...:...:..|||:||:||:..|
Zfish    81 FSPDELSVKVTDDYVEIQGKHGERQDDHGYISREFHRRYRLPSNVDQSAITCTLSADGLLTLCGP 145

  Fly   145 KPPAIEDKGNERIVQI 160
            |...|:....:|.:.:
Zfish   146 KTSGIDAGRGDRTIPV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 37/77 (48%)
IbpA <69..161 CDD:223149 41/92 (45%)
cryaaNP_694482.1 Crystallin 1..48 CDD:278926 5/31 (16%)
alpha-crystallin-Hsps_p23-like 61..146 CDD:294116 37/84 (44%)
IbpA <64..146 CDD:223149 37/81 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.