DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and HSPB9

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_149971.1 Gene:HSPB9 / 94086 HGNCID:30589 Length:159 Species:Homo sapiens


Alignment Length:78 Identity:22/78 - (28%)
Similarity:36/78 - (46%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHD-EKEDGHGVISR--HFIRKYILPKGYDPNEV 185
            |:|||:.::...||..||.|:.....::|.||.. :..|...|..|  ..:.:.:||....|..:
Human    51 RDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAM 115

  Fly   186 HSTLSSDGILTVK 198
            ...|:..|.|.|:
Human   116 TCCLTPSGQLWVR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 22/78 (28%)
DNA_pol3_delta2 <218..>381 CDD:331068
HSPB9NP_149971.1 ACD_HspB9_like 45..131 CDD:107236 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148930
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.