DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and AT1G07400

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_172220.1 Gene:AT1G07400 / 837252 AraportID:AT1G07400 Length:157 Species:Arabidopsis thaliana


Alignment Length:135 Identity:37/135 - (27%)
Similarity:64/135 - (47%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KELGDKGTSGASGSTSGQPAASKSAYSVVNRNGFQVSM-NVKQFAANELTVKTIDNCIV-VEGQ- 155
            |||  :..|..||.||....|..........:.|:..: .:|:   .|:.|:..|:.:: :.|: 
plant    30 KEL--QFPSSLSGETSAITNARVDWKETAEAHVFKADLPGMKK---EEVKVEIEDDSVLKISGER 89

  Fly   156 HDEKED----GHGV--ISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLERQE 214
            |.|||:    .|.|  .|..|.||:.||:....::|.::: .:|:|||..|   .|.:...:.|.
plant    90 HVEKEEKQDTWHRVERSSGQFSRKFKLPENVKMDQVKASM-ENGVLTVTVP---KVEEAKKKAQV 150

  Fly   215 RIVDI 219
            :.:||
plant   151 KSIDI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 23/84 (27%)
DNA_pol3_delta2 <218..>381 CDD:331068 2/2 (100%)
AT1G07400NP_172220.1 ACD_ScHsp26_like 49..140 CDD:107229 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.