DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and HSP17.6A

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_196764.1 Gene:HSP17.6A / 831076 AraportID:AT5G12030 Length:156 Species:Arabidopsis thaliana


Alignment Length:173 Identity:39/173 - (22%)
Similarity:72/173 - (41%) Gaps:46/173 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KSLVELEKELGDKGTSGASGS--TSGQPAASKSAYSVVNRNGFQVSMNVKQFAANELTVK-TIDN 148
            :.::|..:|..:|..:..|.:  ...:..|:..|..:.:.:.:..::::.....:|:.|: ..:|
plant    15 EDMLEAPEEQTEKTRNNPSRAYMRDAKAMAATPADVIEHPDAYVFAVDMPGIKGDEIQVQIENEN 79

  Fly   149 CIVVEG--QHDEKEDGHGV----ISRH---FIRKYILPKGYDPNEVHSTLSSDGILTV---KAPP 201
            .:||.|  |.|.||: .||    :.|.   |:||:.||...|..:: |...:||:|.|   |.||
plant    80 VLVVSGKRQRDNKEN-EGVKFVRMERRMGKFMRKFQLPDNADLEKI-SAACNDGVLKVTIPKLPP 142

  Fly   202 PLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSEVEQQAA 244
            |                             :|.||..::.|.|
plant   143 P-----------------------------EPKKPKTIQVQVA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 25/88 (28%)
DNA_pol3_delta2 <218..>381 CDD:331068 5/27 (19%)
HSP17.6ANP_196764.1 HSP20 49..137 CDD:365807 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.