powered by:
Protein Alignment Hsp67Ba and AT4G21870
DIOPT Version :9
Sequence 1: | NP_523998.1 |
Gene: | Hsp67Ba / 39076 |
FlyBaseID: | FBgn0001227 |
Length: | 445 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_193918.1 |
Gene: | AT4G21870 / 828276 |
AraportID: | AT4G21870 |
Length: | 134 |
Species: | Arabidopsis thaliana |
Alignment Length: | 55 |
Identity: | 17/55 - (30%) |
Similarity: | 26/55 - (47%) |
Gaps: | 9/55 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 FIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQ 224
|.||:.||:..|...: |....||:|||..| |..:.| |::|...:.:
plant 80 FKRKFRLPESIDMIGI-SAGYEDGVLTVIVP------KRIMTR--RLIDPSDVPE 125
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
51 |
1.000 |
Domainoid score |
I4315 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.