DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and AT2G19310

DIOPT Version :10

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_179521.1 Gene:AT2G19310 / 816448 AraportID:AT2G19310 Length:162 Species:Arabidopsis thaliana


Alignment Length:86 Identity:21/86 - (24%)
Similarity:36/86 - (41%) Gaps:21/86 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 HFIRKYILPKGYDPNEVHSTLSSDGILTV-----------KAP--PPLPVVKGSLERQERIVDIQ 220
            |..:.| || |.|.:||.:.:..:|.|.:           |.|  .....|...:|.:..:|.: 
plant    71 HVFKAY-LP-GVDQDEVIAFVDEEGYLQICTGDNKFMSRFKLPNNALTDQVTAWMEDEFLVVFV- 132

  Fly   221 QISQQQKDKDAQPPKPSEVEQ 241
                 :||..:.||:..|:|:
plant   133 -----EKDASSSPPQLPEIEE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 11/41 (27%)
Agg_substance 226..>432 CDD:411439 6/16 (38%)
AT2G19310NP_179521.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 61..134 CDD:469641 15/70 (21%)

Return to query results.
Submit another query.