DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hspb11

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001092897.1 Gene:hspb11 / 796767 ZFINID:ZDB-GENE-030131-5148 Length:205 Species:Danio rerio


Alignment Length:124 Identity:34/124 - (27%)
Similarity:66/124 - (53%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEK-EDGHGVIS---RHFIRKYILPKGYDPNEVHS 187
            :.::::.:.|:..||.||.:...:.|.|:.::| :||.|..|   :.|.:::.||:|.:|..|..
Zfish    87 YALTLDTQDFSPEELAVKQVGRKLRVSGKTEKKQDDGKGSYSYRCQEFRQEFDLPEGVNPESVSC 151

  Fly   188 TLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSE--VEQQAA 244
            :| ::|.|.::||.     :|:....||::.| ..:...|:...|..:|..  ||.:||
Zfish   152 SL-NNGQLQIQAPR-----EGNTVSNERVIPI
-TYTPAVKNPALQNSEPENQAVEAEAA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 21/76 (28%)
DNA_pol3_delta2 <218..>381 CDD:331068 8/29 (28%)
hspb11NP_001092897.1 IbpA 36..177 CDD:223149 26/95 (27%)
ACD_HspB9_like 81..164 CDD:107236 22/77 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..205 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582861
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.