DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hspb6

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001094428.1 Gene:hspb6 / 792610 ZFINID:ZDB-GENE-080214-7 Length:142 Species:Danio rerio


Alignment Length:148 Identity:48/148 - (32%)
Similarity:74/148 - (50%) Gaps:27/148 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VPIKGQSAASQHRHHPYNRVAGAKTACCNKSLVELEKELGDKGTSGASGSTSGQ---PAASKSAY 119
            ||:.|         .|:.||           |..|...|  .||.|....|..:   |...::..
Zfish     9 VPVSG---------IPWERV-----------LPPLFPRL--NGTIGPYSWTPTEFLIPVTEQTGA 51

  Fly   120 SVV--NRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDP 182
            |.|  :.|||.|.::||.|:..||.||...:.:||||:|::|:||.|:::|.|.|:|.:|.|.:.
Zfish    52 SKVTCDHNGFTVEVDVKHFSPEELLVKVSGDYVVVEGKHEQKKDGSGLVTRQFNRRYRIPNGVNI 116

  Fly   183 NEVHSTLSSDGILTVKAP 200
            ..:.|.:|.:|:|.:.||
Zfish   117 MALESAMSPEGMLVISAP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 30/75 (40%)
DNA_pol3_delta2 <218..>381 CDD:331068
hspb6NP_001094428.1 metazoan_ACD 53..135 CDD:107247 33/82 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.