DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb3

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:129 Identity:40/129 - (31%)
Similarity:64/129 - (49%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RVAGAKTACCNKSLVELEKELG-DKGTSGASGSTSGQPAASKSAYSVVNRNGFQVSMNVKQFAAN 139
            |:..|..|....::.:|.|..| .|..:..|.|....|...||.        ||:.::|.||...
  Rat    29 RLDHALYALPGPTIEDLRKARGTPKALAEDSDSAETPPGEGKSR--------FQILLDVVQFLPE 85

  Fly   140 ELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPL 203
            ::.::|.:..::::.||..:.|.||.|||.|.|:|.||.|.:..::.:.|..||||.|:...||
  Rat    86 DIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVETKDLSAILCHDGILVVEVKDPL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 26/75 (35%)
DNA_pol3_delta2 <218..>381 CDD:331068
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69 5/20 (25%)
ACD_HspB3_Like 65..147 CDD:107232 29/89 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342773
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.