DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hspb1

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001072817.1 Gene:hspb1 / 780278 XenbaseID:XB-GENE-480320 Length:211 Species:Xenopus tropicalis


Alignment Length:139 Identity:55/139 - (39%)
Similarity:77/139 - (55%) Gaps:24/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PYNRVAGAKTACCNKSLVELEKELGDKGTSGAS--GSTSGQPAASKSAYSVVNRNGFQVSMNVKQ 135
            |....|||.....|::   |.::|    :||.|  ..||.|               :::|::|..
 Frog    67 PPTTPAGATAPDFNRA---LSRQL----SSGISEIRQTSDQ---------------WKISLDVNH 109

  Fly   136 FAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAP 200
            ||..||.:||.|..:.:.|:|:||:|.||.|||.|.|||.||.|.|.|:|.|:||.||||||:||
 Frog   110 FAPEELVIKTKDGIVEITGKHEEKQDEHGFISRCFTRKYTLPPGVDINKVASSLSPDGILTVEAP 174

  Fly   201 PPLPVVKGS 209
            .|.|.::.:
 Frog   175 LPKPAIQSA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 38/75 (51%)
DNA_pol3_delta2 <218..>381 CDD:331068
hspb1NP_001072817.1 ACD_HspB1_like 90..175 CDD:107230 44/99 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6892
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.