DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb2

DIOPT Version :10

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_077761.3 Gene:Hspb2 / 69253 MGIID:1916503 Length:182 Species:Mus musculus


Alignment Length:135 Identity:44/135 - (32%)
Similarity:72/135 - (53%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SGQPAASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRK 173
            :|:.|.:.::...::...||..::|..|..:|:||:|:||.:.|..:|.::.|.||.:||.|.|.
Mouse    56 AGEGARAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRT 120

  Fly   174 YILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSE 238
            |:||...||..|.:.||.||||.::||           |..|.:| .::::........||.|.|
Mouse   121 YVLPADVDPWRVRAALSHDGILNLEAP-----------RGGRHLD-TEVNEVYISLLPAPPDPEE 173

  Fly   239 VEQQA 243
            .|:.|
Mouse   174 EEEIA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 31/75 (41%)
Agg_substance 226..>432 CDD:411439 6/18 (33%)
Hspb2NP_077761.3 Crystallin <21..51 CDD:425732
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 67..148 CDD:469641 33/91 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.