DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb2

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_077761.3 Gene:Hspb2 / 69253 MGIID:1916503 Length:182 Species:Mus musculus


Alignment Length:135 Identity:44/135 - (32%)
Similarity:72/135 - (53%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SGQPAASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRK 173
            :|:.|.:.::...::...||..::|..|..:|:||:|:||.:.|..:|.::.|.||.:||.|.|.
Mouse    56 AGEGARAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRT 120

  Fly   174 YILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSE 238
            |:||...||..|.:.||.||||.::||           |..|.:| .::::........||.|.|
Mouse   121 YVLPADVDPWRVRAALSHDGILNLEAP-----------RGGRHLD-TEVNEVYISLLPAPPDPEE 173

  Fly   239 VEQQA 243
            .|:.|
Mouse   174 EEEIA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 31/75 (41%)
DNA_pol3_delta2 <218..>381 CDD:331068 7/26 (27%)
Hspb2NP_077761.3 alpha-crystallin-Hsps_p23-like 67..148 CDD:381838 33/91 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838962
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.