DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb3

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_064344.1 Gene:Hspb3 / 56534 MGIID:1928479 Length:154 Species:Mus musculus


Alignment Length:127 Identity:42/127 - (33%)
Similarity:64/127 - (50%) Gaps:20/127 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SLVELEKELGDKGTSGA----SGSTSGQPAASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDN 148
            ::.:|.|..| .||..|    |.||...|...||.        ||:.::|.||...::.::|.:.
Mouse    41 TIEDLSKARG-AGTPQALAEDSASTEKPPGEGKSR--------FQILLDVVQFLPEDIIIQTFEG 96

  Fly   149 CIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSL 210
            .::::.||..:.|.||.|||.|.|:|.||.|.:..::.:.|..||||.|:       ||.||
Mouse    97 WLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVETKDLSAILCHDGILVVE-------VKDSL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 26/75 (35%)
DNA_pol3_delta2 <218..>381 CDD:331068
Hspb3NP_064344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..71 8/23 (35%)
ACD_HspB3_Like 67..149 CDD:107232 30/96 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.