DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hspb15

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001092202.1 Gene:hspb15 / 555589 ZFINID:ZDB-GENE-080214-5 Length:154 Species:Danio rerio


Alignment Length:107 Identity:37/107 - (34%)
Similarity:61/107 - (57%) Gaps:5/107 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KELGDKGTSGASGSTSGQPAASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDE 158
            ||:..|..:|:.|..|     ......::....::|.::|..|:..|::|||.|..:.:.|.|:|
Zfish    11 KEIPSKSCTGSEGHVS-----DAVCEQMIGEQDWKVCLDVGPFSPEEISVKTRDGYLEITGNHEE 70

  Fly   159 KEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAP 200
            :::.|.:|||.|.|||.||...|..::.|.||.||:|:|:||
Zfish    71 RQENHRLISRSFARKYKLPADLDLKQISSMLSPDGVLSVEAP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 29/75 (39%)
DNA_pol3_delta2 <218..>381 CDD:331068
hspb15NP_001092202.1 metazoan_ACD 35..113 CDD:107247 31/78 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7249
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.