DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hspb2

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001017744.1 Gene:hspb2 / 550439 ZFINID:ZDB-GENE-050417-260 Length:169 Species:Danio rerio


Alignment Length:95 Identity:38/95 - (40%)
Similarity:60/95 - (63%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSS 191
            ::|.::|.||..:|::|:|:||.:.|..:|.::.|.||.:||.|.|.||||.|.||..|..:||.
Zfish    71 YRVLLDVCQFTPDEISVRTVDNLLEVSARHAQRMDQHGFVSREFTRTYILPMGVDPLLVQVSLSH 135

  Fly   192 DGILTVKAP-------PPLPVVKGSLERQE 214
            ||||.::||       |.:..:|..:|::|
Zfish   136 DGILCIQAPRKTEDLEPQINQLKIKVEKKE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 32/72 (44%)
DNA_pol3_delta2 <218..>381 CDD:331068
hspb2NP_001017744.1 ACD_HspB2_like 63..145 CDD:107231 33/73 (45%)
IbpA <64..162 CDD:223149 36/90 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582841
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.