DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb7

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_113795.1 Gene:Hspb7 / 50565 RGDID:62021 Length:169 Species:Rattus norvegicus


Alignment Length:75 Identity:23/75 - (30%)
Similarity:39/75 - (52%) Gaps:3/75 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTL 189
            :.::.:::::.|:..::.|.|.:|.|.|..   ||....|.:...|..|..||:..||..|.|.|
  Rat    79 DAYEFTVDMRDFSPEDIIVTTSNNHIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSAL 140

  Fly   190 SSDGILTVKA 199
            ..||.||::|
  Rat   141 REDGSLTIRA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 23/75 (31%)
DNA_pol3_delta2 <218..>381 CDD:331068
Hspb7NP_113795.1 IbpA 39..166 CDD:223149 23/75 (31%)
ACD_HspB7_like 72..152 CDD:107234 23/75 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.