powered by:
Protein Alignment Hsp67Ba and Hspb7
DIOPT Version :9
Sequence 1: | NP_523998.1 |
Gene: | Hsp67Ba / 39076 |
FlyBaseID: | FBgn0001227 |
Length: | 445 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_113795.1 |
Gene: | Hspb7 / 50565 |
RGDID: | 62021 |
Length: | 169 |
Species: | Rattus norvegicus |
Alignment Length: | 75 |
Identity: | 23/75 - (30%) |
Similarity: | 39/75 - (52%) |
Gaps: | 3/75 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 NGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTL 189
:.::.:::::.|:..::.|.|.:|.|.|.. ||....|.:...|..|..||:..||..|.|.|
Rat 79 DAYEFTVDMRDFSPEDIIVTTSNNHIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSAL 140
Fly 190 SSDGILTVKA 199
..||.||::|
Rat 141 REDGSLTIRA 150
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166342793 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.