DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hsp67Ba and hspb7

DIOPT Version :9

Sequence 1:	NP_523998.1	Gene:	Hsp67Ba / 39076	FlyBaseID:	FBgn0001227	Length:	445	Species:	Drosophila melanogaster
Sequence 2:	NP_001006040.1	Gene:	hspb7 / 450019	ZFINID:	ZDB-GENE-041010-136	Length:	161	Species:	Danio rerio

Alignment Length:	141	Identity:	42/141 - (29%)
Similarity:	59/141 - (41%)	Gaps:	30/141 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    86 NKSLVELEKELGDKGTSGASGSTSGQPAASKS----------------AYSVVNRNG-------- 126
            |.|....|:......:|.:|.|||..|...||                |....||.|
Zfish     5 NSSAYRSERSYHQTSSSSSSSSTSANPYMEKSRGLFADDFGSFMCPKDALGFPNRTGTVGNIKTL 69

  Fly   127 ---FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHST 188
               :|.:::|:.|:..::.|.|.:|.|.|   |.||....|.:...|..|..||:..||..|.|:
Zfish    70 GDTYQFTVDVQDFSPEDVIVTTSNNQIEV---HAEKLASDGTVMNTFTHKCRLPEDVDPTSVKSS 131

  Fly   189 LSSDGILTVKA 199
            |.:||.||:||
Zfish   132 LGADGTLTIKA 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hsp67Ba	NP_523998.1	metazoan_ACD	124..200	CDD:107247	29/87 (33%)
Hsp67Ba	NP_523998.1	DNA_pol3_delta2	<218..>381	CDD:331068
hspb7	NP_001006040.1	ACD_HspB7_like	64..144	CDD:107234	27/82 (33%)
hspb7	NP_001006040.1	IbpA	<65..158	CDD:223149	27/81 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170582890
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.840