DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hspb8

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001005658.1 Gene:hspb8 / 448147 XenbaseID:XB-GENE-945643 Length:202 Species:Xenopus tropicalis


Alignment Length:169 Identity:50/169 - (29%)
Similarity:79/169 - (46%) Gaps:37/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 HHPYNRVAGAKTACCNKSLVE--LEKELG-----------------DKGTSGASGS------TSG 110
            |:|.||..|::.....:.|..  |:::.|                 .:.||..||.      .||
 Frog    11 HYPSNRHRGSRDPFREQGLSSRLLDEDFGIPPFSDDLTMDWPDWARPRLTSAWSGPLRSGLVRSG 75

  Fly   111 Q-PAASKSAY--------SVVN-RNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGV 165
            . |....|.|        :|.| ...::|.:||:.|...||||||.|..:.|.|.|:|::...|:
 Frog    76 MPPPVYNSRYTGYPDARNTVANISQPWKVCVNVQTFKPEELTVKTKDGFVEVSGNHEEQQKEGGI 140

  Fly   166 ISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAP--PP 202
            :|::|.:|:.||...|...|.::||.:|:|.::||  ||
 Frog   141 VSKNFTKKFQLPPEVDAQTVFASLSPEGLLIIEAPVVPP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 27/75 (36%)
DNA_pol3_delta2 <218..>381 CDD:331068
hspb8NP_001005658.1 alpha-crystallin-Hsps_p23-like 86..175 CDD:381838 29/88 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.