DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and cryabb

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_021331756.1 Gene:cryabb / 436943 ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio


Alignment Length:132 Identity:50/132 - (37%)
Similarity:79/132 - (59%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PAASKSAYSVV--NRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKY 174
            |:..:|..|.|  .::.|.:|::||.||..||:||.|.:.|.:..:|::::||||.:||.|:|||
Zfish    47 PSWMESGVSEVKMEKDQFSLSLDVKHFAPEELSVKIIGDFIEIHAKHEDRQDGHGFVSREFLRKY 111

  Fly   175 ILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSEV 239
            .:|.|.||..:.|:|||||:|||..|..|.      :..||.:.| .:::..|...|.|.|..::
Zfish   112 RVPVGVDPASITSSLSSDGVLTVTGPLKLS------DGPERTIAI-PVTRDDKTTVAGPQKRKKL 169

  Fly   240 EQ 241
            :|
Zfish   170 KQ 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 36/75 (48%)
DNA_pol3_delta2 <218..>381 CDD:331068 6/24 (25%)