DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hsp23

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster


Alignment Length:243 Identity:86/243 - (35%)
Similarity:122/243 - (50%) Gaps:65/243 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLIPFILDLAEELHDFNRSLAMDIDDSAGFGLYPLEATSQLPQLSRGLGRGNAMMWVPIKGQSA 65
            |:.||.:|.||::                                   |||   |..||.. :..
  Fly     1 MANIPLLLSLADD-----------------------------------LGR---MSMVPFY-EPY 26

  Fly    66 ASQHRHHPYNRVAGAKTACCNKSLVELEKELGDKGTSGASGSTSGQPAASKSAYSVVNRNGFQVS 130
            ..|.:.:||..:.|.    ..:.|.:|||::|  .:||:||           |.|.:.::||||.
  Fly    27 YCQRQRNPYLALVGP----MEQQLRQLEKQVG--ASSGSSG-----------AVSKIGKDGFQVC 74

  Fly   131 MNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGIL 195
            |:|..|..:||.||..||.::|||.|:|:||.||.|:|||:|:|.||.||:.::|.|||||||:|
  Fly    75 MDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVL 139

  Fly   196 TVKAPPPLPVV--KGSLERQERIVDIQQISQQQKDKDAQPPKPSEVEQ 241
            |:|.|.| |.:  ||:    ||||.|||:.....:....|.:  .|||
  Fly   140 TIKVPKP-PAIEDKGN----ERIVQIQQVGPAHLNVKENPKE--AVEQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 43/75 (57%)
DNA_pol3_delta2 <218..>381 CDD:331068 7/24 (29%)
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 43/77 (56%)
IbpA <69..161 CDD:223149 52/96 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469597
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.