DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hsp67Bc

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster


Alignment Length:324 Identity:86/324 - (26%)
Similarity:125/324 - (38%) Gaps:132/324 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IPFILDLAEELHDFNRSLAMDIDDSAGFG--LYPLEATSQLPQLSRGLGRGNAMMWVPIKGQSA- 65
            |||:|:|             |..||..:|  ::|.....:|.      .|.:..:.:...|..| 
  Fly     4 IPFVLNL-------------DSPDSMYYGHDMFPNRMYRRLH------SRQHHDLDLHTLGLIAR 49

  Fly    66 ASQHRHHPYNRVAGAKTACCNKSLVELEKELGDKGTSGASGSTSGQPAASKSAYSVVNRNG-FQV 129
            ...|.||   .||..:..           ||......|||                 |:.| |:|
  Fly    50 MGAHAHH---LVANKRNG-----------ELAALSRGGAS-----------------NKQGNFEV 83

  Fly   130 SMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGI 194
            .::|..|...|||||.::.||||||:|:|:||.||.:||||:|:|.|||.:|.:.:.||||.||:
  Fly    84 HLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGV 148

  Fly   195 LTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSEVEQQAAASATTSTLNPTAPTP 259
            |.:..||    :....|.:|||:.|:.:.            ||::.|                  
  Fly   149 LNITVPP----LVSKEELKERIIPIKHVG------------PSDLFQ------------------ 179

  Fly   260 TPSLSLTLAESNGNGQEETEMEMPAVSPPISNEAAAAAAVAVEAPSTAGTTSSANNGVAEPESE 323
                       ||||.:|                             ||..:||    :|||::
  Fly   180 -----------NGNGHKE-----------------------------AGPAASA----SEPEAK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 39/76 (51%)
DNA_pol3_delta2 <218..>381 CDD:331068 16/106 (15%)
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 41/95 (43%)
IbpA <79..170 CDD:223149 45/94 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469595
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.