DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hsp22

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster


Alignment Length:124 Identity:50/124 - (40%)
Similarity:84/124 - (67%) Gaps:8/124 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 SVVNRNGFQVSMNVKQFAANELTVKTIDNCIV-VEGQHDEKE-DGHGVISRHFIRKYILPKGYDP 182
            :.||::|::::::||.:  :||.||.:|..:| |||:.:::| :..|..||||:|:::||:||:.
  Fly    57 ATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEA 119

  Fly   183 NEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSEVEQ 241
            ::|.|||||||:||:..|.| |.|:.:|  :||.|.|:|..:..| |.|:.|......|
  Fly   120 DKVTSTLSSDGVLTISVPNP-PGVQETL--KEREVTIEQTGEPAK-KSAEEPNDKAASQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 33/77 (43%)
DNA_pol3_delta2 <218..>381 CDD:331068 7/24 (29%)
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 43/101 (43%)
metazoan_ACD 61..138 CDD:107247 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469604
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.