DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hspb1

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001008615.2 Gene:hspb1 / 368243 ZFINID:ZDB-GENE-030326-4 Length:199 Species:Danio rerio


Alignment Length:93 Identity:41/93 - (44%)
Similarity:61/93 - (65%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SAYSVVNRNG--FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKG 179
            |..|.|.:.|  :::|::|..|:..||.|||.|..:.:.|:|:|::|.||.|||.|.|||.||.|
Zfish    90 SGMSEVKQTGDSWKISLDVNHFSPEELNVKTKDGVLEITGKHEERKDEHGFISRCFTRKYTLPPG 154

  Fly   180 YDPNEVHSTLSSDGILTVKAPPPLPVVK 207
            .|..::.|.||.:|:|||:||.|.|.::
Zfish   155 VDSEKISSCLSPEGVLTVEAPLPKPAIQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 34/77 (44%)
DNA_pol3_delta2 <218..>381 CDD:331068
hspb1NP_001008615.2 ACD_HspB1_like 91..176 CDD:107230 37/84 (44%)
IbpA <94..191 CDD:223149 39/89 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7249
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.